PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G07150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 308aa    MW: 34528.4 Da    PI: 8.4995
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G07150.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l  +++++G g+W+  ++  g++R++k+c++rw +yl
  LPERR06G07150.1 14 KGPWTPEEDEKLMSYIQKHGHGSWRVLPELAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.31.6e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++ +++++  lG++ W+tIa++++ gRt++++k++w+++l
  LPERR06G07150.1  67 RGNFSREEEQTILHLHSILGNK-WSTIAKHLP-GRTDNEIKNFWNSHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.022961IPR017930Myb domain
SuperFamilySSF466894.3E-3211108IPR009057Homeodomain-like
SMARTSM007171.1E-141363IPR001005SANT/Myb domain
PfamPF002492.7E-171461IPR001005SANT/Myb domain
CDDcd001671.47E-111661No hitNo description
PROSITE profilePS5129426.61862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2765117IPR009057Homeodomain-like
SMARTSM007172.4E-1666114IPR001005SANT/Myb domain
PfamPF002499.8E-1667112IPR001005SANT/Myb domain
CDDcd001672.39E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGRPPCCDEN GLKKGPWTPE EDEKLMSYIQ KHGHGSWRVL PELAGLNRCG KSCRLRWTNY  60
LKPDIKRGNF SREEEQTILH LHSILGNKWS TIAKHLPGRT DNEIKNFWNS HLRKRLIKLG  120
IDPMTHRPRT DFFQSLPQLI ALANLRHIIE QRPWDGHIEG LQTVAVQAAK LKYMKSLLHS  180
AVSTEASPTN SSSNLNTITT ELEQKKLLSP PIPQVPSSSV PESAGKVSHN QMPSTLPDQQ  240
IGRTNLFSNN IMNGDEWCST EAENGSQKSM LVPENLLPPL TDMPVPNFCN TISIPNCDSS  300
NSIPPLPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655921.10.0PREDICTED: myb-related protein 330-like
TrEMBLA0A0D9WNE20.0A0A0D9WNE2_9ORYZ; Uncharacterized protein
STRINGOB06G17320.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-98myb domain protein 93